Pokerstars countries guide - where is legal to play Pokerstars 2024
Have you ever wondered if you can join the Pokerstars? Look no further: our Pokerstars country guide is everything you need to know about where to roll. AuthorVargosoPublished7/29/2023Updated7/29/2023
Have you ever wondered if you can join Pokerstars? Look no further: our Pokerstars country guide is everything you need to know about where to roll.
PokerStars: where to roll?
Pokerstars is literally known worldwide and it would seem that you could play on PS anywhere. However, this is not the case. And the question of “Where can I legally play at Pokerstars?” is a very relevant one.
To save you time, we’ve compiled an up-to-date list of the countries where Pokerstars is now allowed.
Remember that as Pokerstars is a licensed online poker room, there are restrictions on underage gambling (18+, and in some countries there may be higher age limits).
- Andorra
- Argentina
- Armenia
- Aruba
- Austria
- Azerbaijan
- Bahamas
- Bahrain
- Bangladesh
- Barbados
- Belarus
- Belgium
- Belize
- Bermuda
- Bolivia
- Bosnia and Herzegovina
- Botswana
- Brazil
- Bulgaria
- Cambodia
- Canada
- Chile
- Costa Rica
- Croatia
- Czech Republic
- Denmark
- Dominican Republic
- Ecuador
- Egypt
- El Salvador
- Estonia
- Faroe Islands
- Finland
- France
- French Polynesia
- Germany
- Ghana
- Greece
- Greenland
- Guatemala
- Honduras
- Hungary
- Iceland
- India
- Indonesia
- Ireland
- Italy
- Jamaica
- Japan
- Kazakhstan
- Kenya
- Kuwait
- Kyrgyzstan
- Latvia
- Lebanon
- Liechtenstein
- Lithuania
- Luxembourg
- Madagascar
- Malaysia
- Malta
- Mauritius
- Mexico
- Moldova
- Monaco
- Mongolia
- Montenegro
- Morocco
- Namibia
- Nepal
- New Caledonia
- New Zealand
- Nicaragua
- Nigeria
- North Macedonia
- Norway
- Oman
- Panama
- Papua New Guinea
- Paraguay
- Peru
- Philippines
- Poland
- Portugal
- Puerto Rico
- Qatar
- Romania
- Rwanda
- Saint Kitts and Nevis
- Saint Lucia
- San Marino
- Senegal
- Serbia
- Seychelles
- Slovakia
- Slovenia
- South Africa
- South Korea
- Spain
- Sri Lanka
- Sweden
- Switzerland
- Taiwan
- Tanzania
- Thailand
- Trinidad and Tobago
- Tunisia
- Turkey
- Uganda
- Ukraine
- United Arab Emirates
- United Kingdom
- Uruguay
- Uzbekistan
- Vatican City
- Venezuela
- Vietnam
- Zambia
PokerStars restricted countries list
Real money poker is prohibited in the following countries and territories:
- Europe: North Macedonia, Netherlands, Russia, Cyprus, Serbia.
- Asia: India, Bangladesh, Malaysia, Pakistan, UAE, Afghanistan, Bhutan, Brunei, East Timor, Georgia, Hong Kong, Iran, Iraq, Israel, Jordan, Bahrain, Kuwait, Maldives, Myanmar, North Korea, Palestine, Qatar, Saudi Arabia, Singapore, Syria, Tajikistan, Turkey, Yemen, China, Taiwan.
- Africa: Egypt, Benin, Burkina Faso, Burundi, Cameroon, CAR, Chad, Congo, Djibouti, Eritrea, Ethiopia, Ghana, Gambia, Guinea, Kenya, Lesotho, Malawi, Libya, Mali, Mauritania, Mozambique, Niger, Nigeria, Rwanda, Sao Tome and Principe, Senegal, Sierra Leone, Somalia, South Africa, Sudan, Swaziland, Tanzania, Togo, Tunisia, Zimbabwe, Western Sahara.
- Americas: Colombia, USA, Anguilla, Antigua and Barbuda, Cuba, Curaçao, Dominica, Gabon, Grenada, Guyana, Haiti, Puerto Rico, Suriname.
- Oceania: Australia, French Polynesia, New Caledonia, Samoa, Fiji, Guam, Kiribati, Marshall Islands, Micronesia, Nauru, Palau, Solomon Islands, Tonga, Tuvalu, Vanuatu.
PokerStars Europe
Europe is very heterogeneous when it comes to gambling legislation.
- Poker reservations of Italy, France, and Spain (Europool).
- Regional sites. In countries with regulated gaming markets, Pokerstars is available via a local domain. These countries have their own payment methods, rules, and restrictions. For example, in Denmark and Germany
- PokerStars.eu with license in Malta. Countries where there are no clear gambling laws and restrictions on Pokerstars.
PokerStars Asia
Pokerstars is banned in China, Israel, and all Muslim countries in the Middle East.
Most Asian players are from:
- India, excluding states where online poker is legal: Tamil Nadu, Andhra Pradesh, Telangana, Assam, Odisha, Sikkim, and Gujarat.
- Japan.
- Thailand.
PokerStars USA and Canada
PokerStars now only officially operates in New Jersey, Pennsylvania, and Michigan. Each state has its own player pool.
In Canada, PokerStars Ontario was launched following the legalisation of online gambling in the province of Ontario (April 2022). Players from the rest of the country can play at pokerstars.com.
PokerStars LatAm
This is currently the most promising region for expansion. Gaming legislation is still in its infancy in most countries.
In Brazil, Mexico, Peru, and Argentina it is possible to play on pokerstars.com. Colombia is the only country where PokerStars is not available.
Even if the local authorities legalise online poker in the future, Stars will do its best to stay in this market.
PokerStars CIS
PokerStars does not operate in Russia, Georgia, Tajikistan, and the Baltic countries
The site was forced to withdraw from Estonia, Latvia, and Lithuania following the legalisation of gambling. It is likely that Pokerstars did not obtain a local licence for commercial reasons.
The PokerStars Sochi site was closed in March 2022.
What should I do if I move to another country?
For professional poker players relocating to another country may offer advantages in terms of better quality of life, tax status, and access to online poker rooms.
If you already have a Pokerstars account registered in another country, you will need to provide clear copies or photos of the following documents:
- A government-issued photo ID with your name, date of issue, and date of birth (national ID card, passport, driver’s licence).
- A utility bill showing your full name, current address, and billing date (no older than 3 months).
- A copy of a bank statement showing recent transactions in your new country of residence.
You can upload documents via the desktop client, mobile app or the Pokerstars website. Access to your account will be restored once document verification is complete.
Future Prospects
Over the past few years, PokerStars management has sought to work within the legal requirements of each jurisdiction and to obtain licences wherever possible.
We believe that in the coming years, PokerStars will seek licences in the Netherlands, Switzerland, and all US states where online poker is legal.
IndependentPokerStars4.54.5Bonus100% up to $600Rakebackup to 60%Sign upReviewContact us to get a deal and start playing now:
Got a question? Let’s chat:Got a question? Let’s chat:AntononlineHead of SupportLive chat
email
telegram
whatsapp
skype
FAQ
✅ Can I use a VPN to play at PokerStars?No. PokerStars does not allow the use of VPNs. Using a VPN may result in your account being blocked.✅ Where can I play at PokerStars?Our article has a list of available countries. However, we’ll save you some time - if you can’t find your country when you sign up, most likely you won’t be able to play at PokerStars.
✅ Is PokerStars legal?Yes, it is. Poker Stars is licensed in the Isle of Man, Malta, and many European countries, as well as states in India and the USA.
✅ Where is PokerStars headquartered?The PokerStars head office is located in the Isle of Man. The headquarters of The Stars Group is located in Toronto, Canada. There are also several other offices in the United Kingdom, Bulgaria, India, and Ireland.✅ Can I play Pokerstars in the US?Yes, PokerStars is legal in the states of New Jersey, Pennsylvania, and Michigan.
Pokerstars is literally known worldwide and it would seem that you could play on PS anywhere. However, this is not the case. And the question of “Where can I legally play at Pokerstars?” is a very relevant one.
To save you time, we’ve compiled an up-to-date list of the countries where Pokerstars is now allowed.
Remember that as Pokerstars is a licensed online poker room, there are restrictions on underage gambling (18+, and in some countries there may be higher age limits).
- Andorra
- Argentina
- Armenia
- Aruba
- Austria
- Azerbaijan
- Bahamas
- Bahrain
- Bangladesh
- Barbados
- Belarus
- Belgium
- Belize
- Bermuda
- Bolivia
- Bosnia and Herzegovina
- Botswana
- Brazil
- Bulgaria
- Cambodia
- Canada
- Chile
- Costa Rica
- Croatia
- Czech Republic
- Denmark
- Dominican Republic
- Ecuador
- Egypt
- El Salvador
- Estonia
- Faroe Islands
- Finland
- France
- French Polynesia
- Germany
- Ghana
- Greece
- Greenland
- Guatemala
- Honduras
- Hungary
- Iceland
- India
- Indonesia
- Ireland
- Italy
- Jamaica
- Japan
- Kazakhstan
- Kenya
- Kuwait
- Kyrgyzstan
- Latvia
- Lebanon
- Liechtenstein
- Lithuania
- Luxembourg
- Madagascar
- Malaysia
- Malta
- Mauritius
- Mexico
- Moldova
- Monaco
- Mongolia
- Montenegro
- Morocco
- Namibia
- Nepal
- New Caledonia
- New Zealand
- Nicaragua
- Nigeria
- North Macedonia
- Norway
- Oman
- Panama
- Papua New Guinea
- Paraguay
- Peru
- Philippines
- Poland
- Portugal
- Puerto Rico
- Qatar
- Romania
- Rwanda
- Saint Kitts and Nevis
- Saint Lucia
- San Marino
- Senegal
- Serbia
- Seychelles
- Slovakia
- Slovenia
- South Africa
- South Korea
- Spain
- Sri Lanka
- Sweden
- Switzerland
- Taiwan
- Tanzania
- Thailand
- Trinidad and Tobago
- Tunisia
- Turkey
- Uganda
- Ukraine
- United Arab Emirates
- United Kingdom
- Uruguay
- Uzbekistan
- Vatican City
- Venezuela
- Vietnam
- Zambia
PokerStars restricted countries list
Real money poker is prohibited in the following countries and territories:
- Europe: North Macedonia, Netherlands, Russia, Cyprus, Serbia.
- Asia: India, Bangladesh, Malaysia, Pakistan, UAE, Afghanistan, Bhutan, Brunei, East Timor, Georgia, Hong Kong, Iran, Iraq, Israel, Jordan, Bahrain, Kuwait, Maldives, Myanmar, North Korea, Palestine, Qatar, Saudi Arabia, Singapore, Syria, Tajikistan, Turkey, Yemen, China, Taiwan.
- Africa: Egypt, Benin, Burkina Faso, Burundi, Cameroon, CAR, Chad, Congo, Djibouti, Eritrea, Ethiopia, Ghana, Gambia, Guinea, Kenya, Lesotho, Malawi, Libya, Mali, Mauritania, Mozambique, Niger, Nigeria, Rwanda, Sao Tome and Principe, Senegal, Sierra Leone, Somalia, South Africa, Sudan, Swaziland, Tanzania, Togo, Tunisia, Zimbabwe, Western Sahara.
- Americas: Colombia, USA, Anguilla, Antigua and Barbuda, Cuba, Curaçao, Dominica, Gabon, Grenada, Guyana, Haiti, Puerto Rico, Suriname.
- Oceania: Australia, French Polynesia, New Caledonia, Samoa, Fiji, Guam, Kiribati, Marshall Islands, Micronesia, Nauru, Palau, Solomon Islands, Tonga, Tuvalu, Vanuatu.
PokerStars Europe
Europe is very heterogeneous when it comes to gambling legislation.
- Poker reservations of Italy, France, and Spain (Europool).
- Regional sites. In countries with regulated gaming markets, Pokerstars is available via a local domain. These countries have their own payment methods, rules, and restrictions. For example, in Denmark and Germany
- PokerStars.eu with license in Malta. Countries where there are no clear gambling laws and restrictions on Pokerstars.
PokerStars Asia
Pokerstars is banned in China, Israel, and all Muslim countries in the Middle East.
Most Asian players are from:
- India, excluding states where online poker is legal: Tamil Nadu, Andhra Pradesh, Telangana, Assam, Odisha, Sikkim, and Gujarat.
- Japan.
- Thailand.
PokerStars USA and Canada
PokerStars now only officially operates in New Jersey, Pennsylvania, and Michigan. Each state has its own player pool.
In Canada, PokerStars Ontario was launched following the legalisation of online gambling in the province of Ontario (April 2022). Players from the rest of the country can play at pokerstars.com.
PokerStars LatAm
This is currently the most promising region for expansion. Gaming legislation is still in its infancy in most countries.
In Brazil, Mexico, Peru, and Argentina it is possible to play on pokerstars.com. Colombia is the only country where PokerStars is not available.
Even if the local authorities legalise online poker in the future, Stars will do its best to stay in this market.
PokerStars CIS
PokerStars does not operate in Russia, Georgia, Tajikistan, and the Baltic countries
The site was forced to withdraw from Estonia, Latvia, and Lithuania following the legalisation of gambling. It is likely that Pokerstars did not obtain a local licence for commercial reasons.
The PokerStars Sochi site was closed in March 2022.
What should I do if I move to another country?
For professional poker players relocating to another country may offer advantages in terms of better quality of life, tax status, and access to online poker rooms.
If you already have a Pokerstars account registered in another country, you will need to provide clear copies or photos of the following documents:
- A government-issued photo ID with your name, date of issue, and date of birth (national ID card, passport, driver’s licence).
- A utility bill showing your full name, current address, and billing date (no older than 3 months).
- A copy of a bank statement showing recent transactions in your new country of residence.
You can upload documents via the desktop client, mobile app or the Pokerstars website. Access to your account will be restored once document verification is complete.
Future Prospects
Over the past few years, PokerStars management has sought to work within the legal requirements of each jurisdiction and to obtain licences wherever possible.
We believe that in the coming years, PokerStars will seek licences in the Netherlands, Switzerland, and all US states where online poker is legal.
IndependentPokerStars4.54.5Bonus100% up to $600Rakebackup to 60%Sign upReview Contact us to get a deal and start playing now:
Got a question? Let’s chat:Got a question? Let’s chat:AntononlineHead of SupportLive chatemailtelegramwhatsappskype
FAQ
✅ Can I use a VPN to play at PokerStars?No. PokerStars does not allow the use of VPNs. Using a VPN may result in your account being blocked.✅ Where can I play at PokerStars?Our article has a list of available countries. However, we’ll save you some time - if you can’t find your country when you sign up, most likely you won’t be able to play at PokerStars.
✅ Is PokerStars legal?Yes, it is. Poker Stars is licensed in the Isle of Man, Malta, and many European countries, as well as states in India and the USA.
✅ Where is PokerStars headquartered?The PokerStars head office is located in the Isle of Man. The headquarters of The Stars Group is located in Toronto, Canada. There are also several other offices in the United Kingdom, Bulgaria, India, and Ireland.✅ Can I play Pokerstars in the US?Yes, PokerStars is legal in the states of New Jersey, Pennsylvania, and Michigan.
PokerStars launched the PokerStars Ontario website in June 2022. Here's all you need to know about the new site and how to migrate.
This site only collects related articles. Viewing the original, please copy and open the following link:Pokerstars countries guide - where is legal to play Pokerstars 2024
